PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005055m
Common NameEUTSA_v10004949mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 160aa    MW: 18001.7 Da    PI: 9.8229
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005055mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.95.5e-23956148
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     krienks rqv+f+kRrng++ KA  LS+LCd  va++i+sstgkly 
  Thhalv10005055m  9 KRIENKSSRQVSFCKRRNGLMEKARQLSILCDSSVALLIVSSTGKLYS 56
                     79********************************************96 PP

2K-box37.97.7e-14711244598
            K-box  45 sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      ++s++ L +Le+q +++l+  R++Knel++e +++lq+kek+l+ en+ L ++l
  Thhalv10005055m  71 NISIESLISLEEQFKTALSVTRARKNELMMELVKTLQEKEKMLRAENQVLVSQL 124
                      57999*********************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-24161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.385161IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-24323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-211056IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.51712130IPR002487Transcription factor, K-box
PRINTSPR004045.4E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-243859IPR002100Transcription factor, MADS-box
PfamPF014867.9E-1070124IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0048587Biological Processregulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MGRRKVEIKR IENKSSRQVS FCKRRNGLME KARQLSILCD SSVALLIVSS TGKLYSSSSG  60
DSKLEETNGD NISIESLISL EEQFKTALSV TRARKNELMM ELVKTLQEKE KMLRAENQVL  120
VSQLTKMEGK RFLETEYERA MSPENSSGNN PPETLPLLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D8e-16261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-16261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-16261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A8e-16261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3mu6_D8e-16261160Myocyte-specific enhancer factor 2A
3mu6_C8e-16261160Myocyte-specific enhancer factor 2A
3mu6_B8e-16261160Myocyte-specific enhancer factor 2A
3mu6_A8e-16261160Myocyte-specific enhancer factor 2A
1tqe_S9e-16161161Myocyte-specific enhancer factor 2B
1tqe_R9e-16161161Myocyte-specific enhancer factor 2B
1tqe_Q9e-16161161Myocyte-specific enhancer factor 2B
1tqe_P9e-16161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1751804e-59AK175180.1 Arabidopsis thaliana mRNA for MADS box protein FCL1, complete cds, clone: RAFL21-59-G18.
GenBankAY1412194e-59AY141219.1 Arabidopsis thaliana MADS-box protein AGL68 mRNA, complete cds.
GenBankAY2314554e-59AY231455.1 Arabidopsis thaliana MADS affecting flowering 5 variant I (MAF5) mRNA, complete cds.
GenBankAY2314564e-59AY231456.1 Arabidopsis thaliana MADS affecting flowering 5 variant II (MAF5) mRNA, complete cds.
GenBankBT0252684e-59BT025268.1 Arabidopsis thaliana At5g65080 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394080.11e-110hypothetical protein EUTSA_v10004949mg
SwissprotQ683D71e-69MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5
TrEMBLV4MJ091e-110V4MJ09_EUTSA; Uncharacterized protein
STRINGBra031884.1-P7e-79(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65060.24e-50MIKC_MADS family protein